Structure
The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al. in 1981. Its full sequence is:
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
The rat and human peptides are identical and differ from the ovine sequence only by 7 amino acids.
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Read more about this topic: Corticotropin-releasing Hormone
Famous quotes containing the word structure:
“If rightly made, a boat would be a sort of amphibious animal, a creature of two elements, related by one half its structure to some swift and shapely fish, and by the other to some strong-winged and graceful bird.”
—Henry David Thoreau (1817–1862)
“In the extent and proper structure of the Union, therefore, we behold a republican remedy for the diseases most incident to republican government.”
—James Madison (1751–1836)
“The structure was designed by an old sea captain who believed that the world would end in a flood. He built a home in the traditional shape of the Ark, inverted, with the roof forming the hull of the proposed vessel. The builder expected that the deluge would cause the house to topple and then reverse itself, floating away on its roof until it should land on some new Ararat.”
—For the State of New Jersey, U.S. public relief program (1935-1943)