Corticotropin-releasing Hormone - Structure

Structure

The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al. in 1981. Its full sequence is:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

The rat and human peptides are identical and differ from the ovine sequence only by 7 amino acids.

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Read more about this topic:  Corticotropin-releasing Hormone

Famous quotes containing the word structure:

    “In the extent and proper structure of the Union, therefore, we behold a republican remedy for the diseases most incident to republican government.”
    —James Madison (1751–1836)

    “The question is still asked of women: “How do you propose to answer the need for child care?” That is an obvious attempt to structure conflict in the old terms. The questions are rather: “If we as a human community want children, how does the total society propose to provide for them?””
    —Jean Baker Miller (20th century)

    “For the structure that we raise,
    Time is with materials filled;
    Our to-days and yesterdays
    Are the blocks with which we build.”
    —Henry Wadsworth Longfellow (1809–1882)