Corticotropin-releasing Hormone - Structure

Structure

The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al. in 1981. Its full sequence is:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

The rat and human peptides are identical and differ from the ovine sequence only by 7 amino acids.

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Read more about this topic:  Corticotropin-releasing Hormone

Famous quotes containing the word structure:

    The structure was designed by an old sea captain who believed that the world would end in a flood. He built a home in the traditional shape of the Ark, inverted, with the roof forming the hull of the proposed vessel. The builder expected that the deluge would cause the house to topple and then reverse itself, floating away on its roof until it should land on some new Ararat.
    —For the State of New Jersey, U.S. public relief program (1935-1943)

    Just as a new scientific discovery manifests something that was already latent in the order of nature, and at the same time is logically related to the total structure of the existing science, so the new poem manifests something that was already latent in the order of words.
    Northrop Frye (b. 1912)

    It is difficult even to choose the adjective
    For this blank cold, this sadness without cause.
    The great structure has become a minor house.
    No turban walks across the lessened floors.
    The greenhouse never so badly needed paint.
    Wallace Stevens (1879–1955)