Human Defensins
Initially human alpha defensin peptides were isolated from the neutrophils and are thus called human neutrophil peptides. Human neutrophil peptides are also known as α-defensins.
Sequences of major human α-defensins:
| Gene | Aliases | Peptide | Sequence |
|---|---|---|---|
| DEFA1 | HNP1 | human neutrophil peptide 1 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| HNP2 | human neutrophil peptide 2 | CYCRIPACIAGERRYGTCIYQGRLWAFCC | |
| DEFA3 | HNP3 | human neutrophil peptide 3 | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| DEFA4 | HNP4 | human neutrophil peptide 4 | VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRV |
| DEFA5 | HD5 | human defensin 5 | ATCYCRHGRCATRESLSGVCEISGRLYRLCCR |
| DEFA6 | HD6 | human defensin 6 | AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL |
HNP-1, HNP-2 and HNP-3 are encoded by two genes DEFA1 and DEFA3 localized at chromosome 8, location 8p23.1. DEFA1 and DEFA3 encode identical peptides except the conversion of the first amino acid from alanine in HNP-1 to aspartic acid in HNP-3; HNP-2 is an N-terminally truncated iso-form lacking the first amino acid. Human neutrophil peptides are found in human atherosclerotic arteries, inhibit LDL metabolism and fibrinolysis and promote Lp(a) binding.
Human neutrophil-derived alpha-defensins (HNPs) are capable of enhancing phagocytosis by mouse macrophages. HNP1-3 have been reported to increase the production of tumor necrosis factor (TNF) and IL-1, while decreasing the production of IL-10 by monocytes. Increased levels of proinflammatory factors (e.g., IL-1, TNF, histamine and prostaglandin D2) and suppressed levels of IL-10 at the site of microbial infection are likely to amplify local inflammatory responses. This might be further reinforced by the capacity of some human and rabbit alpha-defensins to inhibit the production of immunosuppressive glucocorticoids by competing for the binding of adrenocorticotropic hormone to its receptor. Moreover, human alpha-defensins can enhance or suppress the activation of the classical pathway of complement in vitro by binding to solid-phase or fluid-phase complement C1q, respectively. The capacity of defensins to enhance phagocytosis, promote neutrophil recruitment, enhance the production of proinflammatory cytokines, suppress anti-inflammatory mediators and regulate complement activation argues that defensins upregulate innate host inflammatory defenses against microbial invasion.
In one small study, a significant increase in alpha-defensin levels was detected in T cell lysates of schizophrenia patients; in discordant twin pairs, unaffected twins also had an increase, although not as high as that of their ill siblings.
The Virtual Colony Count antibacterial assay was originally developed to measure the activity of all six human alpha defensins on the same microplate.
Read more about this topic: Alpha Defensin
Famous quotes containing the word human:
“What a phenomenon it has beenscience fiction, space fictionexploding out of nowhere, unexpectedly of course, as always happens when the human mind is being forced to expand; this time starwards, galaxy-wise, and who knows where next.”
—Doris Lessing (b. 1919)